PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0720s0002.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family B3
Protein Properties Length: 571aa    MW: 64444.3 Da    PI: 4.8874
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0720s0002.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B342.89.4e-1416100899
                          -HHHHTT-EE--HHH.HTT.---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
                   B3   8 sdvlksgrlvlpkkfaeeh.ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                           ++++ + l +p  f e++ +g + +++   l++ ++ + W+v +   +++    + +GW eF++a++Lk+g f+vFk+dg + f  +v+
  Kalax.0720s0002.1.p  16 LHNFAAN-LAIPVAFYEKYlEGRPGCGTRAELRSrLRRQGWKVGM--VGRR----IVDGWAEFADAHELKVGYFLVFKYDGGTVF--HVS 96 
                          4556655.9***********9999**********778899*****..7777....889*********************998888..*** PP

                          EE-S CS
                   B3  96 vfrk 99 
                          vf++
  Kalax.0720s0002.1.p  97 VFDT 100
                          *997 PP

2B3469.8e-151432211194
                          HHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
                   B3  11 lksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                          ++   l +p  f+ +++++  +s +++++de g+ W vk++ +k++++++  +GW++Fv+ ngL+ gD + F  ++ +++ +v+
  Kalax.0720s0002.1.p 143 TS---LHFPACFCVANKLNVSCS-EIIVKDEAGEAWPVKVKCKKGGNAVYTMGGWRSFVEGNGLQKGDRFNFCIVS-KGKIPVL 221
                          33...56999******9998887.****************9999999999999****************9998655.3433444 PP

3B339.97.8e-133494301498
                          T-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
                   B3  14 grlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                            l++p  f +++++++ +  ++ +ed +g+ W v+++ +++s+ ++ ++GW +F + ng++ gD   F++++  ++++v++++r
  Kalax.0720s0002.1.p 349 TSLYFPVYFSRANNLDS-C-SEIDVEDDRGKLWPVNIRLKRNSNLVYTAGGWTSFIRGNGIRKGDRYEFRVIS-YGTKPVLSFRR 430
                          34689999999999983.4.49************************************************987.67778877765 PP

4B348.81.3e-15470562697
                          ..-HHHHTT-EE--HHH.HTT...---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
                   B3   6 tpsdvlksgrlvlpkkfaeeh...ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92 
                          ++  +l ++rl l  +fa+ +   +    +s +++l++++g+sW  +l+ +++s+r+++t+GW eF+ angL++g ++ +++++ +++ l
  Kalax.0720s0002.1.p 470 ITQASLDRSRLFLGINFAKMNglaD--RDRSGDMILRNSQGKSWVATLKREGNSSRFFITSGWTEFALANGLEAGRVFRLEVVEPESKLL 557
                          4566778889***********7533..347779****************9*****************************99887666656 PP

                          EEEEE CS
                   B3  93 vvkvf 97 
                          ++k+ 
  Kalax.0720s0002.1.p 558 TLKLT 562
                          66665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.103.1E-155103IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.55E-165107IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.4338101IPR003340B3 DNA binding domain
CDDcd100179.22E-15999No hitNo description
SMARTSM010191.1E-1311101IPR003340B3 DNA binding domain
PfamPF023621.3E-920100IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.104.1E-14128224IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.9E-16129225IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.801130226IPR003340B3 DNA binding domain
CDDcd100174.77E-13132206No hitNo description
SMARTSM010191.4E-10133227IPR003340B3 DNA binding domain
PfamPF023626.9E-13141224IPR003340B3 DNA binding domain
PROSITE profilePS5086311.871336431IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.1E-11336432IPR015300DNA-binding pseudobarrel domain
CDDcd100172.87E-12336430No hitNo description
SuperFamilySSF1019362.16E-13338430IPR015300DNA-binding pseudobarrel domain
SMARTSM010195.7E-12343432IPR003340B3 DNA binding domain
PfamPF023626.8E-11350430IPR003340B3 DNA binding domain
CDDcd100171.81E-13464556No hitNo description
PROSITE profilePS5086313.014465565IPR003340B3 DNA binding domain
SuperFamilySSF1019361.84E-15465557IPR015300DNA-binding pseudobarrel domain
SMARTSM010192.8E-14466565IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.3E-13467559IPR015300DNA-binding pseudobarrel domain
PfamPF023626.5E-14469564IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 571 aa     Download sequence    Send to blast
MANPSPKIPH FFQPLLHNFA ANLAIPVAFY EKYLEGRPGC GTRAELRSRL RRQGWKVGMV  60
GRRIVDGWAE FADAHELKVG YFLVFKYDGG TVFHVSVFDT SACEVEYGDE HDEDDAVEGD  120
GEELKMDSGQ TSYVGTLRPS YLTSLHFPAC FCVANKLNVS CSEIIVKDEA GEAWPVKVKC  180
KKGGNAVYTM GGWRSFVEGN GLQKGDRFNF CIVSKGKIPV LSFRRIGMRD QAEVATRAKR  240
RKAVEVPELD TSAGKVECPS LDEDEDGDVE EDDEEDTVEE DDDEDLSEED YEEEDMVKED  300
YDEEDMVDGD DEEHKTELDH SRKRIKNRNP ATDESTASYV GKMCRAYLTS LYFPVYFSRA  360
NNLDSCSEID VEDDRGKLWP VNIRLKRNSN LVYTAGGWTS FIRGNGIRKG DRYEFRVISY  420
GTKPVLSFRR IGPIHKAALE EEEKVPELAL RHFEKTTGSL IPGKYLIRTI TQASLDRSRL  480
FLGINFAKMN GLADRDRSGD MILRNSQGKS WVATLKREGN SSRFFITSGW TEFALANGLE  540
AGRVFRLEVV EPESKLLTLK LTRRVTLEDL *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31640.14e-41B3 family protein